DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and HLH3B

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster


Alignment Length:267 Identity:54/267 - (20%)
Similarity:99/267 - (37%) Gaps:92/267 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 NARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGF 229
            |.|||.|.:.|:..||.||:.:|....:            |||||.|.||.|::||:.|..:|.:
  Fly   171 NTRERWRQQNVSGAFAELRKLVPTHPPD------------KKLSKNEILRSAIKYIKLLTGILEW 223

  Fly   230 D-----FPPLNSQGNSSGSGDDSFMFIKDEFDCLDEHFDDSLSNYEMDEQQTVQQTLSEDMLNPP 289
            .     ..|:.:|...:.:                   |:.::|....:        .|::.|| 
  Fly   224 QQRQAPSHPIRAQMEPNNN-------------------DNRMANGHAAD--------GENLENP- 260

  Fly   290 QASDLLPSLTTLNGLQYIRIPGTNTYQLLTTDLLGDLSHEQKLEETAASGQLSRSPV---PQKVV 351
               |:.|       :::|:...|:          |.: |...:....|:|......:   |..||
  Fly   261 ---DVPP-------VRHIKCERTD----------GQM-HRNGIGHGHANGNAGNDLLMIAPGAVV 304

  Fly   352 RS------------PCSSPVSPVASTEL-LLQTQTCATPL----------QQQVIKQEYVSTNIS 393
            :|            |.:.|..|:.:..| :.:||..:..:          .::.:|.|..:|::|
  Fly   305 KSELLLESTLPLGHPLNGPPLPLTTAPLAMAETQRISGTVSGVKSASGRSSKRRLKPEGGATDLS 369

  Fly   394 SSSNAQT 400
            .....:|
  Fly   370 LGKRRRT 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 17/51 (33%)
HLH3BNP_525055.1 HLH 171..222 CDD:197674 23/62 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.