DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and l(1)sc

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster


Alignment Length:236 Identity:80/236 - (33%)
Similarity:102/236 - (43%) Gaps:79/236 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 KRPLGESQKQNRHNQQNQQLSKTSVPAKKCKTNKKLAVERPPKAGTISHPHKSQSDQSFGTPGRK 153
            |.|||.||.||.  ||:||   ::|........||......|                      .
  Fly    41 KIPLGTSQLQNM--QQSQQ---SNVGPMLSSQKKKFNYNNMP----------------------Y 78

  Fly   154 GLPLPQAVARRNARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVE 218
            |..|| :|||||||||||||||||||..||:.:|:.|..:.  ...|||:|||||||:|||:|||
  Fly    79 GEQLP-SVARRNARERNRVKQVNNGFVNLRQHLPQTVVNSL--SNGGRGSSKKLSKVDTLRIAVE 140

  Fly   219 YIRSLEKLL---------------------GFDFPPLN----------------SQGNS------ 240
            |||.|:.:|                     |..:...|                :|.:|      
  Fly   141 YIRGLQDMLDDGTASSTRHIYNSADESSNDGSSYNDYNDSLDSSQQFLTGATQSAQSHSYHSASP 205

  Fly   241 ----SGSGDDSFMFIKDEFDCLDEHFD--DSLSNYEMDEQQ 275
                |||......:||.|....|..||  ||.|:.:.|:::
  Fly   206 TPSYSGSEISGGGYIKQELQEQDLKFDSFDSFSDEQPDDEE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 31/51 (61%)
l(1)scNP_476623.1 HLH <96..146 CDD:278439 31/51 (61%)
Peptidase_C11 <128..218 CDD:304483 23/89 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467873
Domainoid 1 1.000 69 1.000 Domainoid score I9565
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103980at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8863
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13935
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.