DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and sc

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster


Alignment Length:435 Identity:111/435 - (25%)
Similarity:165/435 - (37%) Gaps:138/435 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VQSAAASTTNTTP--ISSQRK-----------RPLGESQKQNRHNQQNQQLSKTSVPA--KKCKT 120
            :.|:..||..|.|  |:|..|           .||.....||:             ||  ...||
  Fly    13 MSSSVLSTNETFPTTINSATKIFRYQHIMPAPSPLIPGGNQNQ-------------PAGTMPIKT 64

  Fly   121 NKKLAVERPPKAGTISHPHKSQSDQSFG-TPGRKGLPLPQAVARRNARERNRVKQVNNGFALLRE 184
            .|     ..|:...::...:|.|..|.| :|....:...|:|.|||||||||||||||.||.||:
  Fly    65 RK-----YTPRGMALTRCSESVSSLSPGSSPAPYNVDQSQSVQRRNARERNRVKQVNNSFARLRQ 124

  Fly   185 KIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGFDFPPLNSQGNSSGSGDDSFM 249
            .||:.:.... .:|.|||..||:|||:|||:||||||.|:.|:    ..||...|...:...:.:
  Fly   125 HIPQSIITDL-TKGGGRGPHKKISKVDTLRIAVEYIRRLQDLV----DDLNGGSNIGANNAVTQL 184

  Fly   250 FIKDEFDCLDE------------------HFDDSLSNYEMDEQQTVQQTLSEDMLNPPQASDLLP 296
            .:     ||||                  ::.:::|...:.:||.:|:   :...:.|     |.
  Fly   185 QL-----CLDESSSHSSSSSTCSSSGHNTYYQNTISVSPLQQQQQLQR---QQFNHQP-----LT 236

  Fly   297 SLTTLNGLQYIRIPGTNTYQLLTTDLLGDLSHEQKLEETAASGQLSRSPVPQKVVRSPCSSPVSP 361
            :|:....|....:||            ||            :|.:|.|...|     .|.||.|.
  Fly   237 ALSLNTNLVGTSVPG------------GD------------AGCVSTSKNQQ-----TCHSPTSS 272

  Fly   362 VASTELLLQTQTCATPLQQQVIKQEYVSTNISSSSNAQTSPQQQQQVQNLGSSPILPAFYDQEPV 426
            ..|: :...:.|.....||       :||::....:.........|:|                 
  Fly   273 FNSS-MSFDSGTYEGVPQQ-------ISTHLDRLDHLDNELHTHSQLQ----------------- 312

  Fly   427 SFYDNVVLPGFKKEFSDILQQDQPNNTTAGCLSDESMIDAIDWWE 471
                      .|.|..:..|.|:.:.|.    .||.::|.|..|:
  Fly   313 ----------LKFEPYEHFQLDEEDCTP----DDEEILDYISLWQ 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 30/51 (59%)
scNP_476803.1 HLH 105..163 CDD:278439 37/58 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467872
Domainoid 1 1.000 69 1.000 Domainoid score I9565
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103980at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8863
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13935
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11783
76.940

Return to query results.
Submit another query.