DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and ac

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster


Alignment Length:334 Identity:84/334 - (25%)
Similarity:118/334 - (35%) Gaps:155/334 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 QSDQSFGTPGRKGLPLPQAVARRNARERNRVKQVNNGFALLREKIPEEVSEAFE--AQGAGRGAS 204
            :|..:|..|         :|.|||||||||||||||||:.||:.||..|.....  .:|.|.||:
  Fly    16 ESSSAFNGP---------SVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGAN 71

  Fly   205 KKLSKVETLRMAVEYIRSLEKLLGFDFPPLNSQGNSSGSGDDSFMFIKDEFDCLDEHFDDSLSNY 269
            ||||||.||:|||||||.|:|:|                                         :
  Fly    72 KKLSKVSTLKMAVEYIRRLQKVL-----------------------------------------H 95

  Fly   270 EMDEQQTVQQTLSEDMLNPPQASDLLPSLTTLNGLQYIRIPGTNTYQLLTTDLLGDLSHEQKLEE 334
            |.|:|:..|..|.:                     |::.......:|.|       .:..|:|: 
  Fly    96 ENDQQKQKQLHLQQ---------------------QHLHFQQQQQHQHL-------YAWHQELQ- 131

  Fly   335 TAASGQLSRSPVPQKVVRSPCSSPVSPVASTELLLQTQTCATPLQQQVIKQEYVSTNISSSSNAQ 399
                            ::||..|             |.:|               .:|||.....
  Fly   132 ----------------LQSPTGS-------------TSSC---------------NSISSYCKPA 152

  Fly   400 TS--PQQQQQVQNLGSSPILPAFYDQEPVSFYDNVVLPGFKKEFSDILQQDQPNNTTAGCLSDES 462
            ||  |         |::|         |.:|:.       |.|.|   .:|..||:.:....||.
  Fly   153 TSTIP---------GATP---------PNNFHT-------KLEAS---FEDYRNNSCSSGTEDED 189

  Fly   463 MIDAIDWWE 471
            ::|.|..|:
  Fly   190 ILDYISLWQ 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 32/53 (60%)
acNP_476824.1 HLH 30..96 CDD:197674 42/106 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445030
Domainoid 1 1.000 69 1.000 Domainoid score I9565
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103980at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8863
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13935
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.