DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and ascl1b

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_571306.1 Gene:ascl1b / 30478 ZFINID:ZDB-GENE-980526-174 Length:195 Species:Danio rerio


Alignment Length:223 Identity:69/223 - (30%)
Similarity:101/223 - (45%) Gaps:59/223 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VQSAAASTTNTTPISSQRKRPLGES-QKQNRHNQQNQQLSKTSVPAKKCKTNKKLAVERPPKAGT 134
            :::...:||..|..|..  :|..|| :||:|..:..::...:|....:||  ::|..        
Zfish     1 MEATVVATTQLTQDSFY--QPFSESLEKQDRECKVLKRQRSSSPELLRCK--RRLTF-------- 53

  Fly   135 ISHPHKSQSDQSFGTPGRKGLPLPQAVARRNARERNRVKQVNNGFALLREKIPEEVSEAFEAQGA 199
                    :...:..|.::    |.||||||.||||||||||.||..||:.:|         .||
Zfish    54 --------NGLGYTIPQQQ----PMAVARRNERERNRVKQVNMGFQTLRQHVP---------NGA 97

  Fly   200 GRGASKKLSKVETLRMAVEYIRSLEKLL------------GFDFPPLNSQGNSSGSGDDSFMFIK 252
               |:||:|||||||.||||||:|::||            |...|.: |...|:|.......:..
Zfish    98 ---ANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAVLQCGVPSPSV-SNAYSAGPESPHSAYSS 158

  Fly   253 DEFDCLDEHFDDSLSNYEMDEQQTVQQT 280
            ||         .|..:...:||:.:..|
Zfish   159 DE---------GSYEHLSSEEQELLDFT 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 28/51 (55%)
ascl1bNP_571306.1 HLH 79..124 CDD:197674 31/56 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..164 6/32 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594063
Domainoid 1 1.000 69 1.000 Domainoid score I9565
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.