DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Lyl1

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001007678.1 Gene:Lyl1 / 304663 RGDID:1359244 Length:278 Species:Rattus norvegicus


Alignment Length:138 Identity:44/138 - (31%)
Similarity:57/138 - (41%) Gaps:35/138 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PPKAGTISHPHKSQSDQSFG---------------TPGRKGLPL-----PQAVARR---NARERN 170
            ||......|||...:....|               .|....|.|     ||.||||   |:|||.
  Rat    96 PPTLALHYHPHPFLNSVYIGPAGPFSIFPNSRLKRRPSHGELDLVDGHQPQKVARRVFTNSRERW 160

  Fly   171 RVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGFDFPPLN 235
            |.:.||..||.||:.:|....:            :||||.|.||:|::||..|.:||......|.
  Rat   161 RQQHVNGAFAELRKLLPTHPPD------------RKLSKNEVLRLAMKYIGFLVRLLRDQAAVLA 213

  Fly   236 SQGNSSGS 243
            |..::.||
  Rat   214 SGPSAPGS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 17/51 (33%)
Lyl1NP_001007678.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
HLH 155..207 CDD:197674 25/63 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..278 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.