DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Ascl4

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_038935995.1 Gene:Ascl4 / 299687 RGDID:1307533 Length:145 Species:Rattus norvegicus


Alignment Length:146 Identity:50/146 - (34%)
Similarity:72/146 - (49%) Gaps:26/146 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KKCKTNKKLAVERPPKAGTIS-----HPHKSQSDQSFGTPGRK---------GLPLPQAVARRNA 166
            :|||:...||:..|.:|..:.     .|.:..:.|......|:         |:..|..:.:||.
  Rat     2 EKCKSAGLLALHSPLRASPLGALARREPCRVSARQDTADCARRRPCPSLPPGGVAEPAFLRQRNE 66

  Fly   167 RERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGFDF 231
            |||.||:.||.|:|.||:.:|.|:            |.::||||||||.|:.||:.|::||....
  Rat    67 RERQRVRCVNEGYARLRQHLPREL------------AGQRLSKVETLRAAIGYIKQLQELLERHR 119

  Fly   232 PPLNSQGNSSGSGDDS 247
            |.|||.|.|..|...|
  Rat   120 PDLNSDGESKASSGAS 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 21/51 (41%)
Ascl4XP_038935995.1 bHLH_SF 57..116 CDD:412148 30/70 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352160
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12323
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.