DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Mesp2

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001099743.1 Gene:Mesp2 / 293046 RGDID:1305959 Length:368 Species:Rattus norvegicus


Alignment Length:317 Identity:79/317 - (24%)
Similarity:111/317 - (35%) Gaps:93/317 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 RPPKAGTISHPHKS-QSDQSFGTPGRKGLPLPQAVARRNARERNRVKQVNNGFAL--LREKIPEE 189
            |||...|  .|.:| ::.|......|:..|.|....|::|.||.:::......||  ||..:|..
  Rat    49 RPPSQST--GPARSARNTQVAPNAPRRARPAPAGGQRQSASEREKLRMRTLARALQELRRFLPPS 111

  Fly   190 VSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGFDFPPLNSQGNSSGSGDDSFMFIKDE 254
            |:.          |.:.|:|:||||:|:.||..|..|||.....|..:...|.            
  Rat   112 VAP----------AGQSLTKIETLRLAIRYIGHLSALLGLSEDSLRRRRRRSA------------ 154

  Fly   255 FDCLDEHF-----DDSLSNYEMDEQQTVQQTLSEDMLNPPQASDLLPSLTT--LNGLQY---IRI 309
             |....|.     |||                     :|.||..|.|||.:  .:||.:   ...
  Rat   155 -DAAFSHRCPQCPDDS---------------------SPSQAQMLGPSLGSDISSGLSWGCPPAC 197

  Fly   310 PGTNTYQLLTTDLLGDLSHEQKLEETAASGQLSR-SPVPQKVVRSPCSSPVSPV-ASTELLLQTQ 372
            ||    .:::.:.||                 || |.|...|....||...||: .|.|....|.
  Rat   198 PG----PIISPENLG-----------------SRISNVDPWVTPPYCSQIQSPLHQSLERAADTS 241

  Fly   373 TCATPLQQQVIKQEYVSTNISSSSNAQTSPQQQQQVQN-----------LGSSPILP 418
            ..|.|.....::......|.:....|.|.|.:..:|..           |||.|:||
  Rat   242 HWAPPHACPGMQISPEPRNKTGHWTASTEPAELTKVYQSLSVSPEPCLALGSPPLLP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 16/53 (30%)
Mesp2NP_001099743.1 HLH 82..135 CDD:278439 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.