DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Ascl2

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_113691.1 Gene:Ascl2 / 24209 RGDID:2159 Length:260 Species:Rattus norvegicus


Alignment Length:305 Identity:77/305 - (25%)
Similarity:97/305 - (31%) Gaps:145/305 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 VPAKKCKTNKKLAVERPPKAGTI--SHPHKSQSDQSFGTPGRKGLPLPQAVARRNARERNRVKQV 175
            ||..........|..|||....:  |...:|.:.::..:..        ||||||.|||||||.|
  Rat    78 VPTSSGVAGACTARRRPPSPELLRCSRRRRSGATEASSSSA--------AVARRNERERNRVKLV 134

  Fly   176 NNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGFDFPPLNSQGNS 240
            |.||..||:.:|.            .||:||||||||||.||||||:|::||.            
  Rat   135 NLGFQALRQHVPH------------GGANKKLSKVETLRSAVEYIRALQRLLA------------ 175

  Fly   241 SGSGDDSFMFIKDEFDCLDEHFDDSLSNYEMDEQQTVQQTLSEDMLNP----------PQASDLL 295
                                            |...|:..||..:|.|          |.||...
  Rat   176 --------------------------------EHDAVRAALSGGLLTPATRPSDVCTQPSASPAS 208

  Fly   296 PSLTTLNGLQYIRIPGTNTYQLLTTDLLGDLSHEQKLEETAASGQLSRSPVPQKVVRSPCSSPVS 360
            .||:.           |:|    :.|.||                              ||.|.|
  Rat   209 ASLSC-----------TST----SPDRLG------------------------------CSEPAS 228

  Fly   361 PVASTELLLQTQTCATPLQQQVIKQEYVSTNISSSSNAQTSPQQQ 405
            |                      :..|.|.:  ||...:|.|..|
  Rat   229 P----------------------RSAYSSED--SSCEGETYPMGQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 27/51 (53%)
Ascl2NP_113691.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..126 12/48 (25%)
HLH 134..176 CDD:197674 28/97 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..239 18/116 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352166
Domainoid 1 1.000 67 1.000 Domainoid score I9554
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9108
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.900

Return to query results.
Submit another query.