DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Ascl5

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001257538.1 Gene:Ascl5 / 226439 MGIID:2685043 Length:188 Species:Mus musculus


Alignment Length:231 Identity:61/231 - (26%)
Similarity:83/231 - (35%) Gaps:78/231 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NQNTIIRKIRDFGMLGAVQSAAASTTNTTPISSQRKRPL---------GESQKQNRHNQQNQQLS 109
            |.| ..|.:.|.|..|.:|....:....||:::  ..||         |.|:.            
Mouse     2 NSN-FCRALVDRGPPGGMQLGVVAPAGQTPLAA--TEPLSNVPFLLYPGHSEP------------ 51

  Fly   110 KTSVPAKKCKTNKKLAVERPPKAGTISHPHKSQSDQSFGTPGRKGLPLPQAVARRNARERNRVKQ 174
                |.....|.....|..|...|...:|.:                 |..:.:||.|||.|||.
Mouse    52 ----PYYDAYTGVFPYVPFPGAFGVYDYPFE-----------------PAFIQKRNERERQRVKC 95

  Fly   175 VNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGFD----FPPLN 235
            ||.|:|.||..:|..::|            |:||||||||.|:.||:.|::||...    .||..
Mouse    96 VNEGYARLRGHLPGALTE------------KRLSKVETLRAAIRYIKYLQELLSATPDGAPPPAT 148

  Fly   236 SQ-----------------GNSSGSGDDSFMFIKDE 254
            |.                 ..||||...|..|::.|
Mouse   149 SPPPAHTGHSNVPQPSSLVAESSGSPFSSSPFLESE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 22/51 (43%)
Ascl5NP_001257538.1 HLH 86..136 CDD:197674 28/61 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848564
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8863
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.