DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Tal1

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_006502972.1 Gene:Tal1 / 21349 MGIID:98480 Length:335 Species:Mus musculus


Alignment Length:284 Identity:72/284 - (25%)
Similarity:99/284 - (34%) Gaps:82/284 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 RDFGMLGAVQSAAASTTNTTPISSQRKRPLGESQKQNRHNQQNQQLSKTSVPAKKCKTNKKLAVE 127
            ||.....||.:.|.....||.:.    ||.|.:...          :..|.||:.....:.:.:.
Mouse    78 RDLKGRDAVAAEARLRVPTTELC----RPPGPAPAP----------APASAPAELPGDGRMVQLS 128

  Fly   128 RPPKAG----------TISHPHKSQSDQSFGTPGR----------KGLPLP----------QAVA 162
            .|..|.          ::|.|..|.....||.|..          |..|.|          ..|.
Mouse   129 PPALAAPAGPGRALLYSLSQPLASLGSGFFGEPDAFPMFTNNNRVKRRPSPYEMEISDGPHTKVV 193

  Fly   163 RR---NARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLE 224
            ||   |:|||.|.:.||..||.||:.||....:            |||||.|.||:|::||..|.
Mouse   194 RRIFTNSRERWRQQNVNGAFAELRKLIPTHPPD------------KKLSKNEILRLAMKYINFLA 246

  Fly   225 KLL-------------GFDFPPLNSQGNSSGSG---DDSFMFIKDEFDCLDEHFDDSLSNYEMDE 273
            |||             |.| |.:.:.|..:|.|   :|....:...........|.:.|.....|
Mouse   247 KLLNDQEEEGTQRAKPGKD-PVVGAGGGGAGGGIPPEDLLQDVLSPNSSCGSSLDGAASPDSYTE 310

  Fly   274 QQTVQQTLSEDMLNPPQASDLLPS 297
            :.|.:.|  ...|:|.    |||:
Mouse   311 EPTPKHT--SRSLHPA----LLPA 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 19/51 (37%)
Tal1XP_006502972.1 bHLH_TS_TAL1 191..255 CDD:381549 31/75 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.