DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and hlh-10

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_505401.2 Gene:hlh-10 / 191402 WormBaseID:WBGene00001954 Length:202 Species:Caenorhabditis elegans


Alignment Length:242 Identity:60/242 - (24%)
Similarity:91/242 - (37%) Gaps:69/242 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ITVH--NVLSESGANALQQHIANQNTIIRKIRDFGM----------LGAVQSAAASTTNTTPISS 86
            :|.|  ..|..|..|.....::::..|::.:...||          |.::..|:||....|    
 Worm     6 MTTHQEEPLDLSTGNHGNSELSDEQQIMQVMESCGMFLQQNLFAWFLQSMLEASASQPQLT---- 66

  Fly    87 QRKRPLGESQKQNRHNQQNQQLSKTSVPAKKCKTNKKLAVERPPKAGTISHPHKSQSDQSFGTPG 151
             :..|.....|:|...:||           |.:.|.:       ...|.|....|:...|.|...
 Worm    67 -QDEPPENDTKENDLVKQN-----------KSEVNDE-------NESTPSPTQNSRRRTSTGKID 112

  Fly   152 RKGLPLPQAVARR---NARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETL 213
            |:  .:.:...||   ||||||||:|::..|..||..:|.|             ...|:||:.||
 Worm   113 RR--MVGKMCTRRYEANARERNRVQQLSKMFDQLRVCLPIE-------------DDAKISKLATL 162

  Fly   214 RMAVEYIRSLEKLLGFDFPPLNSQGNSSGSGDDSFMFIKD---EFDC 257
            ::|..||..|..:|         |.||    :|...|.|.   |.:|
 Worm   163 KVASSYIGYLGAIL---------QENS----NDEEEFKKQLQVELEC 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 15/51 (29%)
hlh-10NP_505401.2 bHLH_SF 121..179 CDD:381792 27/79 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.