powered by:
Protein Alignment ase and hlh-15
DIOPT Version :9
Sequence 1: | NP_476694.1 |
Gene: | ase / 30985 |
FlyBaseID: | FBgn0000137 |
Length: | 486 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508440.1 |
Gene: | hlh-15 / 183427 |
WormBaseID: | WBGene00001959 |
Length: | 89 |
Species: | Caenorhabditis elegans |
Alignment Length: | 61 |
Identity: | 24/61 - (39%) |
Similarity: | 31/61 - (50%) |
Gaps: | 12/61 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 167 RERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLL 227
|||.||:..|..|:.||..:|....| |||||:|.||.::.||..|:.||
Worm 40 RERIRVESFNMAFSQLRALLPTLPVE------------KKLSKIEILRFSIAYISFLDNLL 88
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.