DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and hlh-14

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_495131.3 Gene:hlh-14 / 182758 WormBaseID:WBGene00001958 Length:148 Species:Caenorhabditis elegans


Alignment Length:218 Identity:53/218 - (24%)
Similarity:79/218 - (36%) Gaps:89/218 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 RNARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLG 228
            ||.|||.||.|||:||.:||.::..            :..:||.||.:|||.||:||:.|:.||.
 Worm     9 RNERERKRVHQVNHGFDVLRNRLQP------------KNHTKKWSKADTLREAVKYIQQLQVLLN 61

  Fly   229 FDFPPLNSQGNSSGSGDDSFMFIKDEFDCLDEHFDDSLSNYEMDEQQTV---QQTLSEDMLNPPQ 290
            .|    ..|.:.|.|..|..|...:.|           :||.:.|:.::   |....::.::.|.
 Worm    62 QD----PQQPSVSSSTPDYTMNNSNNF-----------NNYAVKEEFSMYLPQNYCPQNQMSVPH 111

  Fly   291 ASDLLPSLTTLNGLQYIRIPGTNTYQLLTTDLLGDLSHEQKLEETAASGQLSRSPVPQKVVRSPC 355
                                             ||:||.                         .
 Worm   112 ---------------------------------GDVSHN-------------------------F 118

  Fly   356 SSPVSPVASTELLLQTQTCATPL 378
            :||.|.|:|:. ...||.|..|:
 Worm   119 NSPTSSVSSSS-YSPTQMCYPPV 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 19/51 (37%)
hlh-14NP_495131.3 bHLH_SF 9..60 CDD:381792 26/62 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14646
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.