DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Mesp2

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_032615.2 Gene:Mesp2 / 17293 MGIID:1096325 Length:370 Species:Mus musculus


Alignment Length:370 Identity:87/370 - (23%)
Similarity:136/370 - (36%) Gaps:103/370 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 QQLSKTSVPAKKCKTNKK---LAVERPPK-AGTISHPHKSQSDQSFGTPGRKGLPLPQAVARRNA 166
            ||...|| ||....::..   .|..||.: ||.......:|:     |..|:..|.|....|::|
Mouse    26 QQSDSTS-PASSSDSSGSCPCYATRRPSQPAGPARSTRTTQA-----TAPRRTRPAPAGGQRQSA 84

  Fly   167 RERNRVKQVNNGFAL--LREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGF 229
            .||.:::......||  ||..:|..|:.          |.:.|:|:||||:|:.||..|..|||.
Mouse    85 SEREKLRMRTLARALQELRRFLPPSVAP----------AGQSLTKIETLRLAIRYIGHLSALLGL 139

  Fly   230 DFPPLNSQGNSSGSGDDSFMFIKDEFDCLDEHFDDSLSNYEMDEQQTVQQTLSEDMLNPPQASDL 294
            ....|..:...|.                     |:..::...:        ..|..:|.||..|
Mouse   140 SEDSLRRRRRRSA---------------------DAAFSHRCPQ--------CPDGGSPSQAQML 175

  Fly   295 LPSLTTL--NGLQY---IRIPGTNTYQLLTTDLLGD-LSHEQKLEETAASGQLSRSPVPQKVVRS 353
            .|||.:.  :|:.:   ...||    .|::.:.||: :|:...........|: :||:.|.:.|:
Mouse   176 GPSLGSAMSSGVSWGCPPACPG----PLISPENLGNRISNVDPWVTPPYCPQI-QSPLHQSLERA 235

  Fly   354 PCSSPVSP-------VASTELLLQTQTCATPLQQQVIKQEYVSTNIS----------------SS 395
            ..|||.:|       ..|.|...:|.......:...:.:.|.|.::|                |.
Mouse   236 ADSSPWAPPQACPGMQMSPEPRNKTGHWTQSTEPAELTKVYQSLSVSPEPCLSLGSPLLLPRPSC 300

  Fly   396 SNAQTSPQQQQQ-------------VQNLGSSPILPAFYDQEPVS 427
            ...|..||.|.|             .::.||||.|     |.||:
Mouse   301 QRLQPQPQPQPQWGCWGHDAEVLSTSEDQGSSPAL-----QLPVA 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 16/53 (30%)
Mesp2NP_032615.2 HLH 80..133 CDD:278439 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.