DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Mesp1

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_032614.2 Gene:Mesp1 / 17292 MGIID:107785 Length:243 Species:Mus musculus


Alignment Length:136 Identity:38/136 - (27%)
Similarity:55/136 - (40%) Gaps:42/136 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 SKTSVPAKKCKTNKKLAVERPPKAGTISHPHKSQSDQSFGTPGRKG-----LPLPQAVARRNARE 168
            ::.|.||..|        .||.:..              |||||:|     |...|   |::|.|
Mouse    44 AQASSPAPPC--------ARPARRA--------------GTPGRRGTHGSRLGSGQ---RQSASE 83

  Fly   169 RNRVKQVNNGFAL--LREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGFDF 231
            |.:::......||  ||..:|..|:.          ..:.|:|:||||:|:.||..|..:||...
Mouse    84 REKLRMRTLARALHELRRFLPPSVAP----------TGQNLTKIETLRLAIRYIGHLSAVLGLSE 138

  Fly   232 PPLNSQ 237
            ..|..|
Mouse   139 DNLRRQ 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 15/53 (28%)
Mesp1NP_032614.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..86 18/66 (27%)
HLH 77..130 CDD:278439 20/65 (31%)
CPLCP 153..157
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..228
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.