DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Ascl2

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_032580.2 Gene:Ascl2 / 17173 MGIID:96920 Length:263 Species:Mus musculus


Alignment Length:257 Identity:68/257 - (26%)
Similarity:82/257 - (31%) Gaps:133/257 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 AVARRNARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLE 224
            ||||||.|||||||.||.||..||:.:|.            .||:||||||||||.||||||:|:
Mouse   119 AVARRNERERNRVKLVNLGFQALRQHVPH------------GGANKKLSKVETLRSAVEYIRALQ 171

  Fly   225 KLLGFDFPPLNSQGNSSGSGDDSFMFIKDEFDCLDEHFDDSLSNYEMDEQQTVQQTLSEDMLNP- 288
            :||.                                            |...|:..|:..:|.| 
Mouse   172 RLLA--------------------------------------------EHDAVRAALAGGLLTPA 192

  Fly   289 ---------PQASDLLPSLTTLNGLQYIRIPGTNTYQLLTTDLLGDLSHEQKLEETAASGQLSRS 344
                     |.||....||:.                                        .|.|
Mouse   193 TPPSDECAQPSASPASASLSC----------------------------------------ASTS 217

  Fly   345 PVPQKVVRSPCSSPVSPVASTELLLQTQTCATPLQQQVIKQEYVSTNISSSSNAQTSPQQQQ 406
            |.|.   |..||.|.||                      :..|.|.  .||...:.||.:|:
Mouse   218 PSPD---RLGCSEPTSP----------------------RSAYSSE--ESSCEGELSPMEQE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 27/51 (53%)
Ascl2NP_032580.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..126 6/6 (100%)
HLH 134..176 CDD:197674 28/97 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..248 19/120 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848568
Domainoid 1 1.000 67 1.000 Domainoid score I9760
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11115
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.