DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Lyl1

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_032561.2 Gene:Lyl1 / 17095 MGIID:96891 Length:278 Species:Mus musculus


Alignment Length:269 Identity:64/269 - (23%)
Similarity:93/269 - (34%) Gaps:104/269 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SPSPPPKENPKENPNPGIKTTLKPFGKITVHNVLSESGANALQQHIANQNTIIRKIRDFGMLGAV 71
            ||:|.|   |.:..:||..:|                      :.:.::||              
Mouse    25 SPAPAP---PSKPASPGPLST----------------------EEVDHRNT-------------- 50

  Fly    72 QSAAASTTNTTP--------ISSQRKRPLGESQKQNRHNQQNQQLSKTSVPAKKCKTNKKLAVER 128
                     .||        |:....||:|.:            :..|.:.|.:....:..|:.|
Mouse    51 ---------CTPWLPPGVPVINLGHTRPIGAA------------MPTTELSAFRPSLLQLTALGR 94

  Fly   129 -PPKAGTISHPHKSQSDQSFG---------------TPGRKGLPL-----PQAVARR---NARER 169
             ||......|||...:....|               .|....|.|     ||.||||   |:|||
Mouse    95 APPTLAVHYHPHPFLNSVYIGPAGPFSIFPNSRLKRRPSHSELDLADGHQPQKVARRVFTNSRER 159

  Fly   170 NRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGFDFPPL 234
            .|.:.||..||.||:.:|....:            :||||.|.||:|::||..|.:||......|
Mouse   160 WRQQHVNGAFAELRKLLPTHPPD------------RKLSKNEVLRLAMKYIGFLVRLLRDQTAVL 212

  Fly   235 NSQGNSSGS 243
            .|..::.||
Mouse   213 TSGPSAPGS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 17/51 (33%)
Lyl1NP_032561.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 8/45 (18%)
bHLH_TS_LYL1 145..209 CDD:381548 31/75 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..278 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.