DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Hand2

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_034532.3 Gene:Hand2 / 15111 MGIID:103580 Length:217 Species:Mus musculus


Alignment Length:114 Identity:40/114 - (35%)
Similarity:52/114 - (45%) Gaps:22/114 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 LAVERPPK----AGTISHPHKSQSDQSFGTPGRKGLPLPQAVARR---NARERNRVKQVNNGFAL 181
            :|:...|:    |..:.|.|........|.||..|   |:.|.||   |.:||.|.:.:|:.||.
Mouse    60 MALSYSPEYASGAAGLDHSHYGGVPPGAGPPGLGG---PRPVKRRGTANRKERRRTQSINSAFAE 121

  Fly   182 LREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGFD 230
            |||.||..            .|..||||::|||:|..||..|..||..|
Mouse   122 LRECIPNV------------PADTKLSKIKTLRLATSYIAYLMDLLAKD 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 19/51 (37%)
Hand2NP_034532.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..116 14/42 (33%)
bHLH_TS_HAND2 100..161 CDD:381477 29/71 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.