DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and TCF23

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_786951.1 Gene:TCF23 / 150921 HGNCID:18602 Length:214 Species:Homo sapiens


Alignment Length:285 Identity:63/285 - (22%)
Similarity:92/285 - (32%) Gaps:118/285 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SQRKR-------PLGESQKQNR------HNQQNQQLSKTSVPAKKCKTNKKLAVERPPKAGTISH 137
            ||||.       .:|.||.|.:      .:::..:||:|               .:.|      .
Human     2 SQRKARGPPAMPGVGHSQTQAKARLLPGADRKRSRLSRT---------------RQDP------W 45

  Fly   138 PHKSQSDQ--SFGTPGRKG-------LPLPQAVARRNARERNRVKQVNNGFALLREKIPEEVSEA 193
            ..:|.|:|  |..|||.:|       |...:|.....||||:||:.:...|..|:..:|....:.
Human    46 EERSWSNQRWSRATPGPRGTRAGGLALGRSEASPENAARERSRVRTLRQAFLALQAALPAVPPDT 110

  Fly   194 FEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGFDFP--------------------PLNSQG 238
                        ||||::.|.:|..||..|.:.||.:.|                    |:.|:.
Human   111 ------------KLSKLDVLVLAASYIAHLTRTLGHELPGPAWPPFLRGLRYLHPLKKWPMRSRL 163

  Fly   239 NSSGSGDDSFMFIKDEFDCLDEHFDDSLSNYEMDEQQTVQQTLSEDMLNPPQASDLLPSLTTLNG 303
            .:.|.|                        |. |...|...|               ||..|.:.
Human   164 YAGGLG------------------------YS-DLDSTTAST---------------PSQRTRDA 188

  Fly   304 LQYIRIPGTNTYQLLTTDL---LGD 325
            ....::||.....|.||.|   |||
Human   189 EVGSQVPGEADALLSTTPLSPALGD 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 12/51 (24%)
TCF23NP_786951.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..86 24/104 (23%)
HLH 83..132 CDD:197674 18/60 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..214 14/55 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.