DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and ASCL4

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_982260.3 Gene:ASCL4 / 121549 HGNCID:24311 Length:172 Species:Homo sapiens


Alignment Length:114 Identity:42/114 - (36%)
Similarity:59/114 - (51%) Gaps:29/114 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 GRKGLPLPQAVA-------RRNARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLS 208
            |.:.||:|...|       :||.|||.||:.||.|:|.||:.:|.|:            |.|:||
Human    57 GWQYLPVPLDSAFEPAFLRKRNERERQRVRCVNEGYARLRDHLPREL------------ADKRLS 109

  Fly   209 KVETLRMAVEYIRSLEKLL-----GFD-----FPPLNSQGNSSGSGDDS 247
            ||||||.|::||:.|::||     |.:     .|...::.||.|....|
Human   110 KVETLRAAIDYIKHLQELLERQAWGLEGAAGAVPQRRAECNSDGESKAS 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 22/51 (43%)
ASCL4NP_982260.3 bHLH_SF 66..129 CDD:412148 31/74 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..172 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158177
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.