DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and Ferd3l

DIOPT Version :10

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_277057.1 Gene:Ferd3l / 114712 MGIID:2150010 Length:168 Species:Mus musculus


Alignment Length:131 Identity:26/131 - (19%)
Similarity:49/131 - (37%) Gaps:39/131 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 PSEEGEDFVDAFLIKMEKDKNEGIQSTFDLETLAVDLYD---LWLAGQETTS------------- 314
            |::.|.:..:......|.|.||          |..|::|   ::|.|:.|.:             
Mouse    50 PNDGGVETAEEATEPAEPDINE----------LCRDMFDKMSVFLQGELTATCEDYKLLENMNKL 104

  Fly   315 TTLTWACACLLNYPEVVKEIRKELTEVTGGTRSLSLTDRPKTPYLGATINEIQRIASILNVNIFR 379
            |:|.:     :...::...|.:.|.::.....||.       |||. .||:|:...:.|....::
Mouse   105 TSLKY-----MEMKDISINISRNLQDLNQKYASLQ-------PYLD-QINQIEEQVTALEQAAYK 156

  Fly   380 L 380
            |
Mouse   157 L 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 bHLH_TS_dAS-C_like 170..227 CDD:381587
Ferd3lNP_277057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..88 9/32 (28%)
bHLH_TS_FERD3L_NATO3 96..159 CDD:381421 14/75 (19%)
bHLH domain 104..159 14/67 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.