DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and ascl2

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_002940290.3 Gene:ascl2 / 100494131 XenbaseID:XB-GENE-6458615 Length:236 Species:Xenopus tropicalis


Alignment Length:171 Identity:61/171 - (35%)
Similarity:77/171 - (45%) Gaps:45/171 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 RHNQQNQQLSKTSVPAKKCKTNKKLAV----------------ERPPKAGTISHPHK----SQSD 144
            ||| :.:...:..||:......|...|                |||.||     |.|    |.|.
 Frog    33 RHN-KGKSFQREQVPSGPTLERKATPVVPVAPPSSAMEEQPGSERPAKA-----PRKVANQSGSP 91

  Fly   145 QSFGTPGRKGLPLPQAVA------RRNARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGA 203
            |......|.| .||.|:.      |||.|||||||.||.|||.||:.:|:           .:|.
 Frog    92 QRLRCQRRSG-SLPNAIGISATSERRNERERNRVKLVNLGFAKLRQHVPQ-----------AQGP 144

  Fly   204 SKKLSKVETLRMAVEYIRSLEKLLGFDFPPLNSQGNSSGSG 244
            :||:|||||||.||||||:|:.:| .:......||.:...|
 Frog   145 NKKMSKVETLRSAVEYIRALQSIL-MERTAGEGQGRAGSDG 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 26/51 (51%)
ascl2XP_002940290.3 bHLH_TS_ASCL2_Mash2 110..174 CDD:381586 36/75 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9148
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9527
Panther 1 1.100 - - O PTHR13935
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 1 1.000 - - X11783
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.140

Return to query results.
Submit another query.