DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and ascl1

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_002944648.3 Gene:ascl1 / 100490701 XenbaseID:XB-GENE-1032967 Length:199 Species:Xenopus tropicalis


Alignment Length:228 Identity:76/228 - (33%)
Similarity:97/228 - (42%) Gaps:70/228 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 QKQNRH-------NQQNQQLSKTSVPAKKCKTNKKLAVERPPKAGTISHPHKSQSDQSFGTPGRK 153
            |:|.:|       ..||.|||    ||::.:..|...::|...    |.|...:..:.....| .
 Frog    16 QQQQQHFLQPACFFPQNVQLS----PAEEHEAAKPKQIKRQRS----SSPELMRCKRRLNFTG-F 71

  Fly   154 GLPLPQ----AVARRNARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLR 214
            |..|||    ||||||.|||||||.||.|||.|||.:|         .||   |:||:|||||||
 Frog    72 GYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVP---------NGA---ANKKMSKVETLR 124

  Fly   215 MAVEYIRSLEKLLGFDFPPLNSQGNSSGSGDDSFMFIKDEFDCLDEHFDDSL------SNYEMDE 273
            .||||||:|::||                         ||.|.:...|...:      .||..|.
 Frog   125 SAVEYIRALQQLL-------------------------DEHDAVSAAFQSGVLSPTISPNYSHDM 164

  Fly   274 QQTVQQTLS-----EDMLNP--PQASDLLPSLT 299
            .......:|     |...:|  |:..:||...|
 Frog   165 NSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTT 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 29/51 (57%)
ascl1XP_002944648.3 bHLH_TS_ASCL1_Mash1 78..148 CDD:381585 46/106 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9148
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9527
Panther 1 1.100 - - LDO PTHR13935
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.