DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and ascl3

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_004913964.2 Gene:ascl3 / 100490616 XenbaseID:XB-GENE-6257824 Length:193 Species:Xenopus tropicalis


Alignment Length:116 Identity:38/116 - (32%)
Similarity:61/116 - (52%) Gaps:24/116 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 PQAVARRNARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRS 222
            |..:.:||.|||.||:.||.|:|.||:.:|.|::|            |:||||||||.|:|||:.
 Frog    85 PAFIRKRNERERERVRCVNEGYARLRQHLPLELAE------------KRLSKVETLRAAIEYIKH 137

  Fly   223 LEKL--LGFDFPPLNSQGNSSGSGDDSFMFIKDEFD----------CLDEH 261
            |:.:  ||...||:....:::.:.....:::..:..          |.:||
 Frog   138 LQNILDLGTLRPPVTEPFSNTETSISPVLYLSTKSSIQRHCAMGSPCTEEH 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 23/51 (45%)
ascl3XP_004913964.2 bHLH_SF 80..143 CDD:412148 31/69 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14093
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.