DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and lyl1

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_009300341.1 Gene:lyl1 / 100333113 ZFINID:ZDB-GENE-090807-1 Length:326 Species:Danio rerio


Alignment Length:353 Identity:81/353 - (22%)
Similarity:117/353 - (33%) Gaps:114/353 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PSPPPK--ENPKENPNPGIKTTLKP---FGKITVHNVLSESGANALQQHIANQNTIIRKIRDFGM 67
            |.||..  ..|.::..|..:.|.:|   ..:.......|.|.:::...|....::  |:      
Zfish    29 PDPPAHACSTPPDHAEPRAQDTQEPGATGAETDSRRSSSSSSSSSRSPHCTTTDS--RR------ 85

  Fly    68 LGAVQSAAASTTNTTPISS--QRKRPLG--------ESQKQNRHNQQNQQLSKTSVPAKKCKTNK 122
                .|::||.....|:.|  ..|.||.        .......|.....:|::.|     |.|..
Zfish    86 ----GSSSASLPAHIPVISLAHSKPPLPPLPLLAALHPAPPPPHGPAELRLAQLS-----CLTGS 141

  Fly   123 KLAVERPPKAGTISHPHKSQS--------------------DQSFGTPGRKGLPLPQAVARR--- 164
            ..|....|.|...:||..|.|                    ...|....|...| ||.:|||   
Zfish   142 SPAAALLPPAFLQTHPFISSSFLMPPAGFGIFSNARMKRRPSTHFEVEIRSDGP-PQKLARRVFT 205

  Fly   165 NARERNRVKQVNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGF 229
            |:|||.|.:.||..|:.||:.||....:            :||||.|.||:|::||..||:||..
Zfish   206 NSRERWRQQNVNGAFSELRKLIPTHPPD------------RKLSKNEILRLAMKYIDFLEQLLND 258

  Fly   230 DFPP-------------------LNSQGNSSGSGDDSFMFIKDEFDCLDEHFDDSLSNYEMDEQQ 275
            ...|                   |.:...||..||                 .||       |:.
Zfish   259 QSQPEETGQRAHAHTPSTHSLLLLTASSGSSCYGD-----------------TDS-------EES 299

  Fly   276 TVQQTLSEDMLNPPQASDLLPSLTTLNG 303
            |..:..|.|   |..:.:.:.:||...|
Zfish   300 TGPRACSTD---PKHSREPILALTVSGG 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 17/51 (33%)
lyl1XP_009300341.1 HLH 206..256 CDD:197674 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.