DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and mespbb

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001252536.1 Gene:mespbb / 100148845 ZFINID:ZDB-GENE-110609-1 Length:244 Species:Danio rerio


Alignment Length:214 Identity:43/214 - (20%)
Similarity:76/214 - (35%) Gaps:69/214 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 KAGTISHPHKSQSDQSFGTPGRKGLPLPQAVARRNARERN--------RVKQVNNGFALLREKIP 187
            :|.::| |....|..||...||..:.:.:...:..:::|.        |::.:......||..:|
Zfish    44 QAQSVS-PKPEISGSSFQDGGRSRVGVRRTRCKNPSKQRQSASEKEKLRMRDLTKALHHLRTYLP 107

  Fly   188 EEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLE----------------KLLGFDFPPLN- 235
            ..|:.          ..:.|:|:||||:.:.||..|.                ::.|:...|.| 
Zfish   108 PSVAP----------VGQTLTKIETLRLTIRYISYLSAQLGLSEESLCKMRDLRVSGYQEMPQNH 162

  Fly   236 ---------SQGNSSGSGDDSFMFIKDEFDCLD-------EHFDDSLSNYEMDEQQTVQQTLSED 284
                     |..||.|:.:.  :..:.:.||..       ..:|||.:            :.||.
Zfish   163 CYSTAEFWGSCQNSCGTSES--VLRRTDMDCRQVFMGMEKPAYDDSFN------------SSSES 213

  Fly   285 MLNPPQASDLLPSLTTLNG 303
            :|..|..:|   |..|..|
Zfish   214 LLESPLYAD---SALTYQG 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 12/51 (24%)
mespbbNP_001252536.1 HLH 80..133 CDD:278439 14/62 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.