DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ase and hand2

DIOPT Version :9

Sequence 1:NP_476694.1 Gene:ase / 30985 FlyBaseID:FBgn0000137 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001093695.1 Gene:hand2 / 100101704 XenbaseID:XB-GENE-481426 Length:210 Species:Xenopus tropicalis


Alignment Length:121 Identity:40/121 - (33%)
Similarity:48/121 - (39%) Gaps:37/121 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 ISHPHKSQSDQSF---------------------GTPGRKGLPLPQAVARR----NARERNRVKQ 174
            ||||..|..|.|.                     |.||.....|.|...:|    |.:||.|.:.
 Frog    43 ISHPEMSPPDYSMAPSYSPEYANGAAGLDHSHYGGVPGSGAGGLMQRPVKRRGTANRKERRRTQS 107

  Fly   175 VNNGFALLREKIPEEVSEAFEAQGAGRGASKKLSKVETLRMAVEYIRSLEKLLGFD 230
            :|:.||.|||.||..            .|..||||::|||:|..||..|..||..|
 Frog   108 INSAFAELRECIPNV------------PADTKLSKIKTLRLATSYIAYLMDLLAKD 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aseNP_476694.1 HLH <172..224 CDD:278439 19/51 (37%)
hand2NP_001093695.1 bHLH_TS_HAND2 93..154 CDD:381477 28/71 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.