DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgcl and YPS5

DIOPT Version :9

Sequence 1:NP_525030.1 Gene:Pgcl / 30984 FlyBaseID:FBgn0011822 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_011255.1 Gene:YPS5 / 852632 SGDID:S000003228 Length:165 Species:Saccharomyces cerevisiae


Alignment Length:117 Identity:34/117 - (29%)
Similarity:46/117 - (39%) Gaps:38/117 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRFQIKSLV--FLAGLIVLVGEANSTLRRIPIQK------------SPNFKRSHKNIVAERDFV 51
            |..|.|.||:  .:..|.|| |.:.|:..:.|:||            |..|||   |.|.....:
Yeast     1 MQLFSILSLLSSLMCSLTVL-GSSASSYVKFPVQKFADIINIGTQDVSTVFKR---NEVLNTTVI 61

  Fly    52 QQKYNRQYTANGYPMEHLSNYDNFQYYGNISIGTPGQDFLVQFDTGSSNLWV 103
                      ||..:          |...:.||||.|...:|.|||||::.|
Yeast    62 ----------NGIGV----------YVVKMEIGTPPQTVYLQLDTGSSDMIV 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PgclNP_525030.1 pepsin_retropepsin_like 67..378 CDD:299705 13/37 (35%)
Asp 76..379 CDD:278455 13/28 (46%)
YPS5NP_011255.1 pepsin_retropepsin_like 65..>100 CDD:416259 13/39 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.