DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgcl and asp-19

DIOPT Version :9

Sequence 1:NP_525030.1 Gene:Pgcl / 30984 FlyBaseID:FBgn0011822 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001123079.1 Gene:asp-19 / 6418790 WormBaseID:WBGene00077655 Length:223 Species:Caenorhabditis elegans


Alignment Length:250 Identity:83/250 - (33%)
Similarity:117/250 - (46%) Gaps:37/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LIVLVGEANSTLRRIPIQKSPNFKRSHKNIVAERDFVQQKYNRQYTANGYPMEHLSNYDNFQYYG 79
            |:.||...::.|    .|.|.|.||               :|:|  ||.|     .|:|: ...|
 Worm     4 LLFLVTTCSAAL----FQASINCKR---------------FNQQ--ANRY-----FNFDD-SCIG 41

  Fly    80 NISIGTPGQDFLVQFDTGSSNLWVPGSSCISTACQDH-----QVFYKNKSSTYVANGTAFSITYG 139
            ||:||||.|...|..||.|:|.||.||.|.|..|..:     ..|...||:::|.....||..||
 Worm    42 NITIGTPPQSASVFMDTTSANWWVIGSKCTSANCNGYSGIRKHKFNTTKSTSFVEGNRTFSTEYG 106

  Fly   140 TGSVSGYLSVDCVGFAGLTIQSQTFGEVTTEQGTNFVDAYFDGILGMGFPSLAVDGVTPTFQNMM 204
            .  .:|||..|.|...||||..|..| :.|..|..|....:.||..:.:|:|:||.|||..|.::
 Worm   107 L--CTGYLGTDTVQMGGLTITKQELG-IATIVGLGFGLKPYVGIFELAWPALSVDQVTPPMQKLI 168

  Fly   205 QQGLVQSPVFSFFL--RDNGSVTFYGGELILGGSDPSLYSGSLTYVNVVQAAYWK 257
            .|..:.:|:|:.:|  :|.|....|.|.:..||.|......::|||.:....:|:
 Worm   169 SQNQLDAPMFTIWLDQKDQGVYVGYTGLITYGGFDNKNCDANVTYVALSSKTFWQ 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PgclNP_525030.1 pepsin_retropepsin_like 67..378 CDD:299705 69/197 (35%)
Asp 76..379 CDD:278455 67/188 (36%)
asp-19NP_001123079.1 pepsin_like 40..>223 CDD:133138 66/185 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162044
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.