DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgcl and mgc108380

DIOPT Version :9

Sequence 1:NP_525030.1 Gene:Pgcl / 30984 FlyBaseID:FBgn0011822 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001027480.1 Gene:mgc108380 / 613072 -ID:- Length:384 Species:Xenopus tropicalis


Alignment Length:395 Identity:150/395 - (37%)
Similarity:219/395 - (55%) Gaps:44/395 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VFLAGLIVLVGEANSTLRRIPIQKSPNFKRSHKNIVAERDFVQQ-----------KY--NRQYT- 60
            |.||.:.:.:.|.   |.|:|:::    .:|.::|:.||..:::           ||  |.:|. 
 Frog     4 VVLAFICLQLSEG---LVRVPLKR----YKSARDIMRERGILKEFMKTHKRDPALKYHFNEKYDF 61

  Fly    61 ANGYPMEHLSNYDNFQYYGNISIGTPGQDFLVQFDTGSSNLWVPGSSCISTACQDHQVFYKNKSS 125
            |..|...::..|    |||.||||||.|:|||.|||||||||||.:||.|.||.:|.:|..::||
 Frog    62 AVAYEPMYMDTY----YYGEISIGTPPQNFLVLFDTGSSNLWVPSTSCQSEACSNHNLFNPSQSS 122

  Fly   126 TYVANGTAFSITYGTGSVSGYLSVDCVGFAGLTIQSQTFGEVTTEQGTNFVDAYFDGILGMGFPS 190
            ||.:||..||::||:|||:|....|.|...||::.:|.||...||.|::|..:.||||.||.:|:
 Frog   123 TYTSNGQQFSMSYGSGSVTGVFGYDTVTVQGLSLNNQEFGLTYTESGSSFYYSKFDGIFGMAYPA 187

  Fly   191 LAVDGVTPTFQNMMQQGLVQSPVFSFFLRDNGSVTFYGGELILGGSDPSLYSGSLTYVNVVQAAY 255
            ::..|.|...|.|:||.|:..|:||.::...      .||:|.||.|.:||||.:.:..|.|..|
 Frog   188 MSAGGATTAMQGMLQQNLLTYPIFSVYMSSQ------SGEVIFGGVDNNLYSGQIQWSPVTQEVY 246

  Fly   256 WKFQTDYIKVGSTS---ISTFAQAIADTGTSLIIAPQAQYDQISQLFNA-NSEGLF--ECSST-S 313
            |:...|...:...:   .|...|||.|||||.:..||.....:.|...| |..|:|  .|:|. :
 Frog   247 WQIGIDEFLINGQATGWCSQGCQAIVDTGTSPLTIPQQYMGTLLQNLGAQNYNGMFVVNCNSVQN 311

  Fly   314 YPDLIININGVDFKIPAKYYIIEEEDFCSLAIQSI------NQDFWIMGDVFLGRIYTEFDVGNQ 372
            .|.:...||||.|.||...||::...:|::.::..      .|..||:|||||.:.|:.:|:.|.
 Frog   312 LPTITFVINGVQFPIPPSGYIVQTNGYCTVGVEETYLPSQNGQPLWILGDVFLRQYYSVYDMSNN 376

  Fly   373 RLGFA 377
            |:|||
 Frog   377 RVGFA 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PgclNP_525030.1 pepsin_retropepsin_like 67..378 CDD:299705 133/324 (41%)
Asp 76..379 CDD:278455 132/315 (42%)
mgc108380NP_001027480.1 A1_Propeptide 17..45 CDD:369623 7/31 (23%)
pepsin_retropepsin_like 71..383 CDD:386101 133/321 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1456
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.