DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgcl and pga4

DIOPT Version :9

Sequence 1:NP_525030.1 Gene:Pgcl / 30984 FlyBaseID:FBgn0011822 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_002942158.1 Gene:pga4 / 496914 XenbaseID:XB-GENE-979768 Length:384 Species:Xenopus tropicalis


Alignment Length:389 Identity:143/389 - (36%)
Similarity:209/389 - (53%) Gaps:26/389 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVFLAGLIVLVGEANSTLRRIPIQKSPNFKRSHKNIVAERDFVQQKYNRQYTANGYP------ME 67
            |:.|.||:||    :..:.::|::|..:|:...:.:....|:: :||.....:..:|      .|
 Frog     3 LLLLLGLVVL----SECVVKVPLRKGESFRNRLQRLGLLGDYL-KKYPYNPASKYFPTLAQSSAE 62

  Fly    68 HLSNYDNFQYYGNISIGTPGQDFLVQFDTGSSNLWVPGSSCISTACQDHQVFYKNKSSTYVANGT 132
            .|.||.:.:|||.||||||.|:|.|.|||||:|||||...|.|:||.:|..|...:|:|:.|..|
 Frog    63 VLQNYMDIEYYGTISIGTPPQEFTVIFDTGSANLWVPSVYCSSSACTNHNRFNPQQSTTFQATNT 127

  Fly   133 AFSITYGTGSVSGYLSVDCVGFAGLTIQSQTFGEVTTEQGTNFVDAYFDGILGMGFPSLAVDGVT 197
            ..||.|||||:||:|..|.:....:.|.:|.||...:|.|:....:.||||||:.|||:|....|
 Frog   128 PVSIQYGTGSMSGFLGYDTLQVGNIKISNQMFGLSESEPGSFLYYSPFDGILGLAFPSIASSQAT 192

  Fly   198 PTFQNMMQQGLVQSPVFSFFLRDNGSVTFYGGELILGGSDPSLYSGSLTYVNVVQAAYWKFQTDY 262
            |.|.||..|||:...:||.:|..:|.   .|..::.||.|.|.|||||.:|.:....||:...|.
 Frog   193 PVFDNMWSQGLIPQNLFSVYLSSDGQ---SGSYVLFGGVDTSYYSGSLNWVPLTAETYWQIILDS 254

  Fly   263 IKVGSTSI--STFAQAIADTGTSLIIAPQAQYDQISQLFNA----NSEGLFECSSTS-YPDLIIN 320
            |.:....|  |...|||.||||||:..|......|.....|    |.:.:..|::.| .|.::..
 Frog   255 ISINGQVIACSQSCQAIVDTGTSLMTGPTTPIANIQYYIGASQDSNGQYVINCNNISNMPTIVFT 319

  Fly   321 INGVDFKIPAKYYIIEEEDFCSLAIQSI-----NQDFWIMGDVFLGRIYTEFDVGNQRLGFAPV 379
            ||||.:.:|...|:.:.:..||...|::     :.|.||:||||:.:.:..||..|..:..|||
 Frog   320 INGVQYPLPPTAYVRQNQQGCSSGFQAMTLPTNSGDLWILGDVFIRQYFVVFDRTNNYVAMAPV 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PgclNP_525030.1 pepsin_retropepsin_like 67..378 CDD:299705 127/322 (39%)
Asp 76..379 CDD:278455 124/314 (39%)
pga4XP_002942158.1 A1_Propeptide 16..44 CDD:369623 4/28 (14%)
pepsin_A 62..382 CDD:133145 127/322 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1456
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.110

Return to query results.
Submit another query.