DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgcl and napsa

DIOPT Version :10

Sequence 1:NP_525030.1 Gene:Pgcl / 30984 FlyBaseID:FBgn0011822 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001005701.1 Gene:napsa / 448214 XenbaseID:XB-GENE-947098 Length:402 Species:Xenopus tropicalis


Alignment Length:135 Identity:22/135 - (16%)
Similarity:53/135 - (39%) Gaps:44/135 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 RTIME-DKIMDEYRY--------------RFKDFKRTHF---------------KNGAIQVNASS 173
            |||:| .:|:..:.|              ..:|.:|.::               .:|..|.|..:
 Frog    19 RTILEMTQILKRHGYCTLGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFN 83

  Fly   174 IFDLLVGSII----NQLLVSERFEQDDQEFEKLKTSLAEALENI--SIIEGFLPLWVLK-SPLMK 231
            |.|.:|..::    |..|:.:..:.       |.::|...:..:  |::.|.:.:|:.: ..::.
 Frog    84 ILDKIVQKVLDDHHNPRLIKDLLQD-------LSSTLCILIRGVGKSVLVGNINIWICRLETILA 141

  Fly   232 WRTKI 236
            |:.::
 Frog   142 WQQQL 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PgclNP_525030.1 Asp 76..379 CDD:394983 22/135 (16%)
napsaNP_001005701.1 A1_Propeptide 20..42 CDD:462326 5/21 (24%)
pepsin_retropepsin_like 61..384 CDD:472175 14/93 (15%)

Return to query results.
Submit another query.