DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgcl and asp-14

DIOPT Version :9

Sequence 1:NP_525030.1 Gene:Pgcl / 30984 FlyBaseID:FBgn0011822 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_509082.2 Gene:asp-14 / 180917 WormBaseID:WBGene00019619 Length:366 Species:Caenorhabditis elegans


Alignment Length:348 Identity:99/348 - (28%)
Similarity:156/348 - (44%) Gaps:46/348 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 TANGYPMEHLSNYDNFQYYGNISIGTPGQDFLVQFDTGSSNLWVPGSSCISTA--CQDHQVFYKN 122
            |..|..:|..|.:    :..|:::|||||.|.|..||.::::.:|..|| .||  |.:.:.|.:.
 Worm    31 TKGGQTLEQTSTF----FVANLTMGTPGQLFTVVIDTSTADIVIPDMSC-KTANNCYNKRRFNQA 90

  Fly   123 KSSTYVANGTAFSITYGTGSVSGYLSVDCVGFAG-----LTIQSQTFGEVTTEQGTNFVDAYFDG 182
            |||:|.|.|..::.....|:..|:.:.|.|....     :||....|.: .|:.|........||
 Worm    91 KSSSYYAYGNKYTYKNNLGTFQGFDAKDTVVIGDRKTDLITIPGVKFMQ-ATDLGLLMDGLGADG 154

  Fly   183 ILGMGFPSLAVDGVTPTFQNMMQQGLVQSPVFSFFLRDNGSVTFYG--GELILGGSDPSLYSGSL 245
            |||:||.:.:..|....|...:..|.:....:|.:|.........|  |.:..||.||...:.:.
 Worm   155 ILGLGFTASSQIGGNSPFVQGVNAGDISGTFYSIWLEHFNQTDDLGTHGVIYYGGFDPVHCAPNP 219

  Fly   246 TYVNVVQA-AYWKFQTDYIKVGSTSIST---FAQAIADTGTSLIIAPQAQYDQISQLFNANSEGL 306
            |||.:..| ||....:.:..|||::.::   :.|...||.|:.|..|:.   .|||:|  :|.|:
 Worm   220 TYVPLASAYAYQLTMSSFKVVGSSATNSNNKYIQTYLDTTTAQIGLPKT---YISQVF--DSLGI 279

  Fly   307 FECSSTS-----YPDLI-IN---------INGVDFKIPAKYYIIEEEDFCSLAIQSINQDFWIMG 356
                ||:     ||.:: .|         ::|....|..:..:|.....|.|.|.. ..|..|:|
 Worm   280 ----STNVMNAIYPTIVPCNTKITLTFGFVSGTTVSITERDLVISFFGTCRLQIIP-TTDRIILG 339

  Fly   357 -DVFLGRIYTEFDVGNQRLGFAP 378
             .::.||. |.||...||:||.|
 Worm   340 LPLYRGRC-TYFDPIMQRVGFTP 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PgclNP_525030.1 pepsin_retropepsin_like 67..378 CDD:299705 96/339 (28%)
Asp 76..379 CDD:278455 95/332 (29%)
asp-14NP_509082.2 pepsin_like 44..361 CDD:133138 94/329 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.