Sequence 1: | NP_476623.1 | Gene: | l(1)sc / 30983 | FlyBaseID: | FBgn0002561 | Length: | 257 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004812.1 | Gene: | HAND1 / 9421 | HGNCID: | 4807 | Length: | 215 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 43/203 - (21%) |
---|---|---|---|
Similarity: | 63/203 - (31%) | Gaps: | 67/203 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 HQHHHQTQQHQLI-----------------------------APKIPLGTSQLQNMQQSQQSNVG 61
Fly 62 PMLSSQKKKFNYNNMPYGEQLPS--------VARRNA----RERNRVKQVNNGFVNLRQHLPQTV 114
Fly 115 VNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDMLDDGTASSTRHIYNSADESSNDGSSYNDYND 179
Fly 180 SLDSSQQF 187 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
l(1)sc | NP_476623.1 | HLH | <96..146 | CDD:278439 | 15/49 (31%) |
Peptidase_C11 | <128..218 | CDD:304483 | 19/60 (32%) | ||
HAND1 | NP_004812.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 53..109 | 14/70 (20%) | |
bHLH_TS_HAND1 | 94..153 | CDD:381522 | 23/68 (34%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 166..198 | 4/22 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4029 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |