DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and HAND1

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_004812.1 Gene:HAND1 / 9421 HGNCID:4807 Length:215 Species:Homo sapiens


Alignment Length:203 Identity:43/203 - (21%)
Similarity:63/203 - (31%) Gaps:67/203 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HQHHHQTQQHQLI-----------------------------APKIPLGTSQLQNMQQSQQSNVG 61
            |.|||....|.::                             ||..|.|               |
Human    11 HHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAG---------------G 60

  Fly    62 PMLSSQKKKFNYNNMPYGEQLPS--------VARRNA----RERNRVKQVNNGFVNLRQHLPQTV 114
            |..::......|.......|.|.        :.||..    :||.|.:.:|:.|..||:.:|...
Human    61 PPPAAAAAATAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVP 125

  Fly   115 VNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDMLDDGTASSTRHIYNSADESSNDGSSYNDYND 179
            .::          ||||:.|||:|..||..|.|:|.....|.....: .|:....||...:....
Human   126 ADT----------KLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAF-KAELKKADGGRESKRKR 179

  Fly   180 SLDSSQQF 187
            .|...:.|
Human   180 ELQQHEGF 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 15/49 (31%)
Peptidase_C11 <128..218 CDD:304483 19/60 (32%)
HAND1NP_004812.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..109 14/70 (20%)
bHLH_TS_HAND1 94..153 CDD:381522 23/68 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..198 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.