DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and AT1G62975

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_683462.1 Gene:AT1G62975 / 842600 AraportID:AT1G62975 Length:259 Species:Arabidopsis thaliana


Alignment Length:177 Identity:40/177 - (22%)
Similarity:67/177 - (37%) Gaps:31/177 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SQQSN-----VGPMLSSQKKKFNYNNMPYGEQLPSVARRNAR------------ERNRVKQVNNG 102
            |.|:|     :...:....||.:..::.||   .:.|.:|..            ||.|.::|::.
plant    31 SYQNNDVFHSITNKIGGSNKKRSLCDITYG---ANEANKNDDDRESKKMKHRDIERQRRQEVSSL 92

  Fly   103 FVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDMLDDGTASSTRHIYNSADES 167
            |..||..||...:    .|.|.:|      |.:..||.||:.||..:.:......| :......:
plant    93 FKRLRTLLPFQYI----QGKRSTS------DHIVQAVNYIKDLQIKIKELNEKRNR-VKKVISAT 146

  Fly   168 SNDGSSYNDYNDSLDSSQQFLTGATQSAQSHSYHSASPTPSYSGSEI 214
            :...|:..:...||.||......::.|.....:.:...||...|.||
plant   147 TTTHSAIEECTSSLSSSAASTLSSSCSCVGDKHITVVVTPCLVGVEI 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 14/49 (29%)
Peptidase_C11 <128..218 CDD:304483 19/87 (22%)
AT1G62975NP_683462.1 bHLH_AtORG2_like 74..150 CDD:381484 20/86 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.