DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and AT5G51780

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001331036.1 Gene:AT5G51780 / 835252 AraportID:AT5G51780 Length:197 Species:Arabidopsis thaliana


Alignment Length:91 Identity:24/91 - (26%)
Similarity:40/91 - (43%) Gaps:12/91 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 ERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDMLDDGTASS 156
            ||.|.:::.:.:.:||..||...:    .|.|.:|      |.:..||.||:.||..:.:  .|.
plant    33 ERQRRQEMASLYASLRSLLPLHFI----KGKRSTS------DQVNEAVNYIKYLQRKIKE--LSV 85

  Fly   157 TRHIYNSADESSNDGSSYNDYNDSLD 182
            .|.........|..|||..|:.:.::
plant    86 RRDDLMVLSRGSLLGSSNGDFKEDVE 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 12/49 (24%)
Peptidase_C11 <128..218 CDD:304483 14/55 (25%)
AT5G51780NP_001331036.1 bHLH_AtORG2_like 25..101 CDD:381484 20/79 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.