DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and bHLH38

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_191256.1 Gene:bHLH38 / 824864 AraportID:AT3G56970 Length:253 Species:Arabidopsis thaliana


Alignment Length:179 Identity:42/179 - (23%)
Similarity:75/179 - (41%) Gaps:41/179 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 QSNVGPMLSSQKKKFNYNNMPYGEQLPSVARR---NARERNRVKQVNNGFVNLRQHLPQTVVNSL 118
            |:::|..:||:..:.:.|        |.|.::   ||.||:|.|::|..|.:||..||.:     
plant    50 QNSLGVSVSSEGNEIDNN--------PVVVKKLNHNASERDRRKKINTLFSSLRSCLPAS----- 101

  Fly   119 SNGGRGSSKKLSKVDTLRIAVEYIRGLQDMLDDGTASSTRHIYNSADE------SSNDGSSYNDY 177
                 ..|||||..:|:..:::||..||..:        :.:....:|      ...|...|:..
plant   102 -----DQSKKLSIPETVSKSLKYIPELQQQV--------KRLIQKKEEILVRVSGQRDFELYDKQ 153

  Fly   178 NDSLDSSQQFLTGATQSAQSH--SYHSASPTPSYSGSEISGG----GYI 220
            .....:|......||:...:.  ...|:|...::|.|.:.||    |::
plant   154 QPKAVASYLSTVSATRLGDNEVMVQVSSSKIHNFSISNVLGGIEEDGFV 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 15/49 (31%)
Peptidase_C11 <128..218 CDD:304483 20/101 (20%)
bHLH38NP_191256.1 HLH 72..124 CDD:278439 20/61 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.