DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and BHLH100

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_181657.1 Gene:BHLH100 / 818723 AraportID:AT2G41240 Length:242 Species:Arabidopsis thaliana


Alignment Length:156 Identity:41/156 - (26%)
Similarity:65/156 - (41%) Gaps:39/156 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LSSQKKKFNYNNMPYGEQLPSVARR---NARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGS 125
            :||:..:...:|       |.|.::   ||.||.|.|::|..|.:||..||.|          ..
plant    46 VSSENNRTLLDN-------PVVMKKLNHNASERERRKKINTMFSSLRSCLPPT----------NQ 93

  Fly   126 SKKLSKVDTLRIAVEYIRGLQDMLDDGTASSTRHIYNSADESSNDGSSYND--YNDSLDSSQQFL 188
            :||||...|:..|::||..||:.:        :.:....:|.|...|...|  |.|....|::.:
plant    94 TKKLSVSATVSQALKYIPELQEQV--------KKLMKKKEELSFQISGQRDLVYTDQNSKSEEGV 150

  Fly   189 TGATQSAQSHSYHSASPTPSYSGSEI 214
            |         ||.|...:...|.:|:
plant   151 T---------SYASTVSSTRLSETEV 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 16/49 (33%)
Peptidase_C11 <128..218 CDD:304483 22/89 (25%)
BHLH100NP_181657.1 bHLH_AtORG2_like 62..136 CDD:381484 26/91 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.