DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and msgn1

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001039104.1 Gene:msgn1 / 733924 XenbaseID:XB-GENE-972085 Length:172 Species:Xenopus tropicalis


Alignment Length:169 Identity:37/169 - (21%)
Similarity:65/169 - (38%) Gaps:50/169 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSICSSKFQQQHYQLTNSNIFLLQHQHHHQTQQHQLIAPKIPLGTSQLQNMQQSQQSNVGPMLS 65
            |.|....|...:.|.|:             ||...|.::|.:         ..:|..|:......
 Frog    28 MASTWDWKNNDERYSLS-------------QTPSPQSLSPAV---------SYESPYSSSSHTQG 70

  Fly    66 SQKKKFNYNNMPY--------GE-------QLPSVA---RRNA--RERNRVKQVNNGFVNLRQHL 110
            .::..|:|:.:.|        |:       ..||:.   ||.|  ||:.|::.:......||.:|
 Frog    71 LEEMPFSYSLLQYPSLCHGDNGDLTKKDHGHKPSMTVQRRRKASEREKLRMRAIAEALHTLRNNL 135

  Fly   111 PQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDML 149
            |     .:.:.||   :.|:|:.||:..:.||..|.::|
 Frog   136 P-----PMYSQGR---QPLTKIQTLKCTINYISELTNLL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 12/49 (24%)
Peptidase_C11 <128..218 CDD:304483 8/22 (36%)
msgn1NP_001039104.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 11/62 (18%)
bHLH_TS_Msgn1 102..167 CDD:381509 22/73 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.