powered by:
Protein Alignment l(1)sc and Msgn1
DIOPT Version :9
Sequence 1: | NP_476623.1 |
Gene: | l(1)sc / 30983 |
FlyBaseID: | FBgn0002561 |
Length: | 257 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001103021.1 |
Gene: | Msgn1 / 689864 |
RGDID: | 1587516 |
Length: | 187 |
Species: | Rattus norvegicus |
Alignment Length: | 72 |
Identity: | 24/72 - (33%) |
Similarity: | 39/72 - (54%) |
Gaps: | 11/72 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 SVARR---NARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGL 145
||.|| :.||:.|::.:.:....||.:||... ..|| :.|:|:.||:..::|||.|
Rat 116 SVQRRRKASEREKLRMRTLADALHTLRNYLPPVY------SQRG--QPLTKIQTLKYTIKYIREL 172
Fly 146 QDMLDDG 152
.|:|:.|
Rat 173 TDLLNGG 179
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.