DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Msgn1

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001103021.1 Gene:Msgn1 / 689864 RGDID:1587516 Length:187 Species:Rattus norvegicus


Alignment Length:72 Identity:24/72 - (33%)
Similarity:39/72 - (54%) Gaps:11/72 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SVARR---NARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGL 145
            ||.||   :.||:.|::.:.:....||.:||...      ..||  :.|:|:.||:..::|||.|
  Rat   116 SVQRRRKASEREKLRMRTLADALHTLRNYLPPVY------SQRG--QPLTKIQTLKYTIKYIREL 172

  Fly   146 QDMLDDG 152
            .|:|:.|
  Rat   173 TDLLNGG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 13/49 (27%)
Peptidase_C11 <128..218 CDD:304483 11/25 (44%)
Msgn1NP_001103021.1 HLH 119..173 CDD:278439 18/61 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.