DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Tcf23

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_001067558.2 Gene:Tcf23 / 688600 RGDID:1586500 Length:215 Species:Rattus norvegicus


Alignment Length:214 Identity:52/214 - (24%)
Similarity:75/214 - (35%) Gaps:83/214 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 APKIP------------LGT----SQLQNMQQ------SQQSNVGPMLSSQKKKFNYNNMPYG-- 79
            ||.:|            |||    |:|...:|      |..::....::|..::.......:|  
  Rat     8 APAMPEAGRNKPKARLLLGTDRKRSRLNRTRQDLWDDTSWSNHRLSRVTSAPRRTRARGTAHGRS 72

  Fly    80 EQLPSVARRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYI-- 142
            |..|..|   ||||.|||.:...|:.|:..||....::          ||||:|.|.:|..||  
  Rat    73 EASPENA---ARERTRVKTLRQAFLALQAALPAVPPDT----------KLSKLDVLVLATSYIAH 124

  Fly   143 ------------------RGLQDM---------------------LDDGTASSTRHIYNSADESS 168
                              |||:.:                     .:..||.||..|  :.|..|
  Rat   125 LTRTLGHELPGPAWPPFLRGLRYLHPLKKWPMRSRLYAGGLGCSGPESTTADSTTTI--ATDHRS 187

  Fly   169 ND---GSSYNDYNDSLDSS 184
            .|   ||..:...|||.:|
  Rat   188 RDAQLGSQVSVATDSLLAS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 17/69 (25%)
Peptidase_C11 <128..218 CDD:304483 26/101 (26%)
Tcf23XP_001067558.2 HLH 80..129 CDD:197674 20/58 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.