DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and ASCL5

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001257530.1 Gene:ASCL5 / 647219 HGNCID:33169 Length:206 Species:Homo sapiens


Alignment Length:73 Identity:33/73 - (45%)
Similarity:43/73 - (58%) Gaps:10/73 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VARRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDML 149
            :.:||.|||.|||.||.|:..||.|||          |..:.|:||||:|||.|:.||:.||::|
Human    85 IQKRNERERQRVKCVNEGYARLRGHLP----------GALAEKRLSKVETLRAAIRYIKYLQELL 139

  Fly   150 DDGTASST 157
            ......||
Human   140 SSAPDGST 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 22/49 (45%)
Peptidase_C11 <128..218 CDD:304483 15/30 (50%)
ASCL5NP_001257530.1 HLH 89..141 CDD:197674 30/61 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158186
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41464
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.