powered by:
Protein Alignment l(1)sc and ASCL5
DIOPT Version :9
Sequence 1: | NP_476623.1 |
Gene: | l(1)sc / 30983 |
FlyBaseID: | FBgn0002561 |
Length: | 257 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001257530.1 |
Gene: | ASCL5 / 647219 |
HGNCID: | 33169 |
Length: | 206 |
Species: | Homo sapiens |
Alignment Length: | 73 |
Identity: | 33/73 - (45%) |
Similarity: | 43/73 - (58%) |
Gaps: | 10/73 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 85 VARRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDML 149
:.:||.|||.|||.||.|:..||.||| |..:.|:||||:|||.|:.||:.||::|
Human 85 IQKRNERERQRVKCVNEGYARLRGHLP----------GALAEKRLSKVETLRAAIRYIKYLQELL 139
Fly 150 DDGTASST 157
......||
Human 140 SSAPDGST 147
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165158186 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm41464 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R3926 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.770 |
|
Return to query results.
Submit another query.