DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and SCX

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001073983.1 Gene:SCX / 642658 HGNCID:32322 Length:201 Species:Homo sapiens


Alignment Length:119 Identity:34/119 - (28%)
Similarity:47/119 - (39%) Gaps:39/119 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 NARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDMLDDGT 153
            |||||:|...||..|..||..:|.          ..:.:||||::|||:|..||..|.::|    
Human    81 NARERDRTNSVNTAFTALRTLIPT----------EPADRKLSKIETLRLASSYISHLGNVL---- 131

  Fly   154 ASSTRHIYNSADESSNDGSSYNDYNDSLDSSQQFLTGATQSAQSHSYHSASPTP 207
                     .|.|:..||...:       |...|.         |:..:.||.|
Human   132 ---------LAGEACGDGQPCH-------SGPAFF---------HAARAGSPPP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 16/49 (33%)
Peptidase_C11 <128..218 CDD:304483 22/80 (28%)
SCXNP_001073983.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92 6/10 (60%)
bHLH_TS_scleraxis 73..140 CDD:381521 26/81 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 148..177 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.