DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Ascl1

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_071779.1 Gene:Ascl1 / 64186 RGDID:71010 Length:233 Species:Rattus norvegicus


Alignment Length:242 Identity:79/242 - (32%)
Similarity:109/242 - (45%) Gaps:69/242 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QHQHHHQTQQHQLIAPKI-PLGTSQLQN-------MQQSQQSNVGPMLSSQKKKFNYNNMPYG-- 79
            |.|...|..|.|  ||:: |:...|...       .|..:|.:..|.|...|::.|::...|.  
  Rat    48 QQQQQQQAPQQQ--APQLSPVADGQPSGGGHKSAAKQVKRQRSSSPELMRCKRRLNFSGFGYSLP 110

  Fly    80 -EQLPSVARRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIR 143
             :|..:|||||.|||||||.||.||..||:|:|        ||  .::||:|||:|||.||||||
  Rat   111 QQQPAAVARRNERERNRVKLVNLGFATLREHVP--------NG--AANKKMSKVETLRSAVEYIR 165

  Fly   144 GLQDMLDDGTASSTRHIYNSADESSNDGSSY-NDYNDSLDSSQQFLTGATQSAQSHSYHSASPTP 207
            .||.:||:..|.|.  .:.:...|.....:| ||.|..                     :.||..
  Rat   166 ALQQLLDEHDAVSA--AFQAGVLSPTISPNYSNDLNSM---------------------AGSPVS 207

  Fly   208 SYSGSEISGGGYIKQELQEQDLKFDSFDSFSDEQPDDEELLDYISSW 254
            |||..|                  .|:|..|   |:::||||: ::|
  Rat   208 SYSSDE------------------GSYDPLS---PEEQELLDF-TNW 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 26/49 (53%)
Peptidase_C11 <128..218 CDD:304483 30/90 (33%)
Ascl1NP_071779.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..95 13/48 (27%)
HLH 131..173 CDD:197674 27/51 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9554
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5061
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - mtm9108
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13935
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2717
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.