DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Ascl3

DIOPT Version :10

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_064435.1 Gene:Ascl3 / 56787 MGIID:1928820 Length:174 Species:Mus musculus


Alignment Length:132 Identity:40/132 - (30%)
Similarity:57/132 - (43%) Gaps:41/132 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IAPKIPLGTSQLQNMQQSQQSNVGPMLSSQKKKFNYNNMPYGEQLP------------------- 83
            :.|:.|:..|....:         |:|.........||  ||:..|                   
Mouse    38 LCPETPVPASYTDEL---------PLLPFSSDTLIMNN--YGDPYPFPFPMPYTNYRRCDYTYGP 91

  Fly    84 -SVARRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQD 147
             .:.:||.|||.|||.||.|:..||:|||:..:          .|:||||:|||.|::||..||.
Mouse    92 AFIRKRNERERQRVKCVNEGYARLRRHLPEDYL----------EKRLSKVETLRAAIKYISYLQS 146

  Fly   148 ML 149
            :|
Mouse   147 LL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 bHLH_TS_dAS-C_like 94..149 CDD:381587 24/54 (44%)
Ascl3NP_064435.1 bHLH_TS_ASCL3 90..148 CDD:381588 29/67 (43%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 92..105 5/12 (42%)
Helix-loop-helix motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 106..144 20/47 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..174
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.