DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Ascl3

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_064435.1 Gene:Ascl3 / 56787 MGIID:1928820 Length:174 Species:Mus musculus


Alignment Length:132 Identity:40/132 - (30%)
Similarity:57/132 - (43%) Gaps:41/132 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IAPKIPLGTSQLQNMQQSQQSNVGPMLSSQKKKFNYNNMPYGEQLP------------------- 83
            :.|:.|:..|....:         |:|.........||  ||:..|                   
Mouse    38 LCPETPVPASYTDEL---------PLLPFSSDTLIMNN--YGDPYPFPFPMPYTNYRRCDYTYGP 91

  Fly    84 -SVARRNARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQD 147
             .:.:||.|||.|||.||.|:..||:|||:..:          .|:||||:|||.|::||..||.
Mouse    92 AFIRKRNERERQRVKCVNEGYARLRRHLPEDYL----------EKRLSKVETLRAAIKYISYLQS 146

  Fly   148 ML 149
            :|
Mouse   147 LL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 21/49 (43%)
Peptidase_C11 <128..218 CDD:304483 13/22 (59%)
Ascl3NP_064435.1 HLH 95..145 CDD:278439 27/59 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..174
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5951
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8863
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.