DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and scxb

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_021328670.1 Gene:scxb / 567817 ZFINID:ZDB-GENE-090806-1 Length:200 Species:Danio rerio


Alignment Length:193 Identity:47/193 - (24%)
Similarity:65/193 - (33%) Gaps:68/193 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NMQQSQQSNVGPMLSSQKKKFNYNNMPYGE-----------------------QLPSVARR---N 89
            ||......|......|:.|.|..::..||.                       .:..|.:|   |
Zfish    19 NMHSEDDDNGSEGSGSEDKSFRTSSHGYGSFKLGVRKKRYSCRPLAIPTELCTPITEVRQRNTAN 83

  Fly    90 ARERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDMLDDGTA 154
            ||||.|...||..|..||..:|.          ..:.:||||::|||:|..||..|.::|..|  
Zfish    84 ARERERTNSVNTAFTALRTLIPT----------EPADRKLSKIETLRLASSYISHLGNVLLVG-- 136

  Fly   155 SSTRHIYNSADESSNDGSSYNDYNDSLDSSQQFLTGATQSAQSHSYH----SASPTPSYSGSE 213
                       |...||      ...|.||....         |.:|    |::|:|....|:
Zfish   137 -----------EECGDG------QPCLRSSGSLF---------HHHHNVSKSSTPSPDSENSQ 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 16/49 (33%)
Peptidase_C11 <128..218 CDD:304483 25/90 (28%)
scxbXP_021328670.1 HLH 78..129 CDD:306515 23/60 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.