DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and MYF6

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_002460.1 Gene:MYF6 / 4618 HGNCID:7566 Length:242 Species:Homo sapiens


Alignment Length:171 Identity:47/171 - (27%)
Similarity:73/171 - (42%) Gaps:31/171 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RRNA---RERNRVKQVNNGFVNLRQHLPQTVVNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDM 148
            ||.|   |||.|:|::|..|..|::   :||.|        .:::|.||:.||.|:.||..|||:
Human    94 RRKAATLRERRRLKKINEAFEALKR---RTVAN--------PNQRLPKVEILRSAISYIERLQDL 147

  Fly   149 LDDGTASSTRHIYNSAD---ESSNDGSSYNDYNDSLDSSQQFLTGATQ--SAQSHSYHSASPTPS 208
            |         |..:..:   |...|..||....::|:.:....|.::|  |...|| .....|..
Human   148 L---------HRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHS-RGLVITAK 202

  Fly   209 YSGSEISGGGYIKQELQEQDLKFDSFDSFSDEQPDDEELLD 249
            ..|:.|....  ...|:......||..|...:.|..||:::
Human   203 EGGASIDSSA--SSSLRCLSSIVDSISSEERKLPCVEEVVE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 15/49 (31%)
Peptidase_C11 <128..218 CDD:304483 26/94 (28%)
MYF6NP_002460.1 Basic 3..98 CDD:416335 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..63
bHLH_TS_MRF4_Myf6 93..156 CDD:381504 27/81 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.