DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Fer2

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster


Alignment Length:194 Identity:43/194 - (22%)
Similarity:76/194 - (39%) Gaps:56/194 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QLTNSNIFLLQHQHHHQTQQHQLIAPKIPLGTSQ-------LQNMQQSQQS-----NVGPMLSSQ 67
            :|:::|:..:|..:...:.::.|.:...|:|...       :.|...:..|     |.|   |:.
  Fly    62 RLSSNNLRHIQQHYMQHSGENLLDSSTNPMGVHNSGGGAPLMCNSPSASSSGGGCGNAG---SAT 123

  Fly    68 KKKFNYNNMPYGEQLPSVA--------RRNARERNRVKQ----------VNNGFVNLRQHLPQTV 114
            .......|..||....:.|        ..|.|||.|:::          :|:.|..||.|:|...
  Fly   124 PGGAGGPNPGYGSVGAATASSYKMQRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFP 188

  Fly   115 VNSLSNGGRGSSKKLSKVDTLRIAVEYIRGLQDMLDD-------------GTASSTRHIYNSAD 165
            .          .|:|||:||||:|:.||..|:::|..             |...:.|..:|::|
  Fly   189 Y----------EKRLSKIDTLRLAIAYISLLREVLQTDYDPLTYVEKCLRGEIKADRANWNTSD 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 17/59 (29%)
Peptidase_C11 <128..218 CDD:304483 16/51 (31%)
Fer2NP_001287359.1 HLH 148..210 CDD:278439 22/71 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.