DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)sc and Fer3

DIOPT Version :9

Sequence 1:NP_476623.1 Gene:l(1)sc / 30983 FlyBaseID:FBgn0002561 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster


Alignment Length:213 Identity:50/213 - (23%)
Similarity:79/213 - (37%) Gaps:69/213 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QHHHQTQQHQLI------------APKIPLGTSQ-------LQNMQQSQQSNVGPML-------- 64
            ||.|...|...:            ||..|:...|       ..::...|:|.|.|::        
  Fly     2 QHPHPIDQPTYMPDVPFQPLWGQEAPPPPIVPYQELIAGFPCTDLSLWQRSQVTPLVPQRPSTNG 66

  Fly    65 -----SSQKKKFNYNNMPYGEQLPSVARR---NARERNRVKQVNNGFVNLRQHLPQTVVNSLSNG 121
                 ||..||..       .::.|:|:|   |.|||.|:..:|..|..||:.:|....      
  Fly    67 RANGSSSSSKKTR-------RRVASMAQRRAANIRERRRMFNLNEAFDKLRRKVPTFAY------ 118

  Fly   122 GRGSSKKLSKVDTLRIAVEYIRGLQDMLDDGTASSTRHIYNSADESSNDGSSYNDYNDSLDSSQQ 186
                .|:||:::|||:|:.||..:.::| .||             .||...|.:|...|::...|
  Fly   119 ----EKRLSRIETLRLAITYIGFMAELL-SGT-------------PSNSHKSRSDVYGSMNGHHQ 165

  Fly   187 FLTGATQSAQSHSYHSAS 204
               ....:...|..|.|:
  Fly   166 ---APPPAIHPHHLHPAA 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)scNP_476623.1 HLH <96..146 CDD:278439 14/49 (29%)
Peptidase_C11 <128..218 CDD:304483 20/77 (26%)
Fer3NP_524322.1 HLH 87..135 CDD:278439 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.